MC34710EW
- Artikelnummer:
- MC34710EW
- Hersteller:
- NXP Semiconductors / Freescale
- Beschreibung:
- IC PWR SUPPLY ADJ DUAL SW 32SOIC
- Bleifreier Status / RoHS Status:
- Bleifrei / RoHS-konform
- verfügbare Anzahl:
- 65871 Pieces
- Lieferzeit:
- 1-2 days
- Datenblatt:
- MC34710EW.pdf
Einführung
We can supply MC34710EW, use the request quote form to request MC34710EW pirce and lead time.XXX.com a professional electronic components distributor. With 3+ Million line items of available electronic components can ship in short lead-time, over 250 thousand part numbers of electronic components in stock for immediately delivery, which may include part number MC34710EW.The price and lead time for MC34710EW depending on the quantity required, availability and warehouse location.Contact us today and our sales representative will provide you price and delivery on Part# MC34710EW.We look forward to working with you to establish long-term relations of cooperation
Spezifikation
| Bedingung | New & Unused, Original Packing |
|---|---|
| Ursprung | Contact us |
| Spannungsversorgung: | 13 V ~ 32 V |
| Supplier Device-Gehäuse: | 32-SOIC EP |
| Serie: | - |
| Verpackung: | Tube |
| Verpackung / Gehäuse: | 32-SSOP (0.295", 7.50mm Width) Exposed Pad |
| Betriebstemperatur: | 0°C ~ 85°C |
| Befestigungsart: | Surface Mount |
| Feuchtigkeitsempfindlichkeitsniveau (MSL): | 3 (168 Hours) |
| Bleifreier Status / RoHS-Status: | Lead free / RoHS Compliant |
| detaillierte Beschreibung: | General Purpose, Supervisor, Sequence PMIC 32-SOIC EP |
| Strom - Versorgung: | 7.5mA |
| Basisteilenummer: | MC34710 |
| Anwendungen: | General Purpose, Supervisor, Sequence |
| Email: | [email protected] |
In Verbindung stehende Teile für MC34710EW
läst Nachrichten
- Mouser liefert Glasfaseranschlüsse für Mil-Aero-Anwendungen
- Jacarem unterzeichnet Franchise für EDAC-Steckverbinder
- Ein Blick vom RISC-V-Gipfel
- Low-Profile-Steckverbinder sind robust genug für die Industrie
- Benötigen Sie eine beleuchtete Tischlupe?
- Die 100Mips DSP-MCU für die Motorsteuerung ist die kleinste von Microchip
- Nicht-ITO-transparente Leiter konkurrieren um den Markt für faltbare Displays
- Electronica: Wasserdichte professionelle Steckverbinder für den Außenbereich
- Seitenerkennungsschalter sind verdammt klein
- Electronica: Video Interview - Datenmodul auf dem PCAP-Touchscreen easyTOUCH
- Electronica: Bluetooth 5 Energy Harvesting-Schalter
- Ordentliche Verpackung für RS232-IO-Link-Konverter für industrielle Netzwerke